Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLA RAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEAN SEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEM CRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFSKFFLKCNQNCLK NAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPS EGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP TIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEII LKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNVSEA SQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGSAAMSNLG GSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVS AVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
    • Molecular weight

      91 kDa including tags
    • Amino acids

      1 to 591

Specifications

Our Abpromise guarantee covers the use of ab132850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COE1
    • COE1_HUMAN
    • Collier, Olf and EBF transcription factor 1
    • Early B cell factor 1
    • Early B-cell factor
    • EBF
    • Ebf1
    • O/E 1
    • O/E-1
    • OE 1
    • OE-1
    • OE1
    • OLF1
    • olfactory neuronal transcription factor 1
    • Transcription factor COE1
    see all
  • Function

    Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.
  • Sequence similarities

    Belongs to the COE family.
    Contains 1 IPT/TIG domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132850 stained with Coomassie Blue.

References

ab132850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up