Description

  • Product name

    Recombinant Human EBF3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNS FSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
    • Amino acids

      381 to 480
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COE 3
    • COE3
    • COE3_HUMAN
    • Early B cell factor 3
    • Early B-cell factor 3
    • EBF 3
    • EBF-3
    • EBF3
    • O/E 2
    • O/E-2
    • O/E2
    • OE 2
    • OE-2
    • OE2
    • Olf 1/EBF like 2
    • Olf-1/EBF-like 2
    • Transcription factor COE3
    see all
  • Function

    Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.
  • Tissue specificity

    Expressed in brain.
  • Sequence similarities

    Belongs to the COE family.
    Contains 1 IPT/TIG domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab166018 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up