Overview

  • Product name
    Recombinant Human Ebf4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPS SPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
    • Amino acids
      1 to 88
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COE4
    • COE4_HUMAN
    • Early B cell factor 4
    • Early B-cell factor 4
    • EBF 4
    • EBF-4
    • Ebf4
    • KIAA1442
    • O/E 4
    • O/E-4
    • OE 4
    • OE-4
    • Olf 1/EBF like 4
    • Olf-1/EBF-like 4
    • RP5-860F19.3
    • Transcription factor COE4
    see all
  • Function
    Transcriptional factor which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.
  • Sequence similarities
    Belongs to the COE family.
    Contains 1 IPT/TIG domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163598 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up