Description

  • Product name

    Recombinant human EBI3 protein (Complex)
    See all EBI3 proteins and peptides
  • Biological activity

    Bioactivity was measured in a cell proliferation assay using anti-CD3 activated Human peripheral mononuclear cells.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGM AARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYK RQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLP ATATMSLGK
    • Predicted molecular weight

      23 kDa
    • Amino acids

      21 to 229
    • Additional sequence information

      Mature protein of EBI3 without signal peptide.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTV EACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLK MYQVEFKTMN AKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTK IKLCILLHAF RIRAVTIDRVMSYLNAS
    • Amino acids

      57 to 253
    • Additional sequence information

      IL12A fused through a polypeptide linker to the Fc portion of Human IgG1.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/ml in sterile PBS.

General Info

  • Alternative names

    • cytokine receptor
    • EBI3
    • EBV induced gene 3 protein
    • EBV-induced gene 3 protein
    • Epstein Barr virus induced 3
    • Epstein Barr virus induced gene 3
    • Epstein Barr virus induced gene 3 protein
    • Epstein-Barr virus-induced gene 3 protein
    • IL 27 subunit beta
    • IL 27B
    • IL-27 subunit beta
    • IL-27B
    • IL27 subunit
    • IL27 subunit beta
    • IL27B
    • IL27B_HUMAN
    • IL35 subunit
    • interleukin 27 subunit beta
    • Interleukin-27 subunit beta
    see all
  • Function

    Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up