Description

  • Product name

    Recombinant Human ECHS1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab100962 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPK ALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNL SFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGE KAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQA GLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGS KLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      28 to 290
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • C80529
    • EC 4.2.1.17
    • ECHS 1
    • Enoyl CoA hydratase 1
    • Enoyl CoA hydratase mitochondrial
    • Enoyl CoA hydratase short chain 1 mitochondrial
    • Enoyl Coenzyme A hydratase short chain 1
    • Enoyl Coenzyme A hydratase short chain 1 mitochondrial
    • Mitochondrial short chain enoyl coenzyme A hydratase 1
    • OTTHUMP00000020811
    • SCEH
    • Short chain enoyl CoA hydratase
    see all
  • Relevance

    ECHS1 (Enoyl Coenzyme A hydratase, short chain, 1) catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs, in the second step of the mitochondrial fatty acid beta-oxidation pathway.
  • Cellular localization

    Mitochondrion matrix.

Images

  • 15% SDS-PAGE showing ab100962 (3 µg) at approximately 30.6 kDa.

References

ab100962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab100962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up