Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPRRLPRGLHCSAAAHSS EQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHS VRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRI FVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRL KLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLP KDSTGAADPPQPHIVGIQSPDQQAALARHNPARPVFVEGPFSLWLRNKCV YYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINE VEEGPVFAMCMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTREL QTSSAGLEEPPLPEDHQEEDDNLQRQQQGQS
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 431

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ecsit
    • ECSIT homolog
    • ECSIT protein
    • ECSIT_HUMAN
    • Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
    • Evolutionarily conserved signaling intermediate in Toll pathways
    • Likely ortholog of mouse signaling intermediate in Toll pathway evolutionarily conserved
    • Protein SITPEC
    • Signaling intermediate in Toll pathway evolutionarily conserved
    • SITPEC
    • SITPEC protein
    see all
  • Function

    Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development (By similarity). Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase.
  • Sequence similarities

    Belongs to the ECSIT family.
  • Cellular localization

    Cytoplasm. Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132231.

References

ab132231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up