Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSGTCGAALTGTSISQVPLPKDSTGAADP PQPHIVGIQSPDQQAALARHNPARPVFVEGPFSLWLRNKCVYYHILRADL LPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEGPVFAM CMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEE PPLPEDHQEEDDNLQRQQQGQS
    • Molecular weight

      25 kDa including tags
    • Amino acids

      19 to 217
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134621 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Ecsit
    • ECSIT homolog
    • ECSIT protein
    • ECSIT_HUMAN
    • Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
    • Evolutionarily conserved signaling intermediate in Toll pathways
    • Likely ortholog of mouse signaling intermediate in Toll pathway evolutionarily conserved
    • Protein SITPEC
    • Signaling intermediate in Toll pathway evolutionarily conserved
    • SITPEC
    • SITPEC protein
    see all
  • Function

    Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development (By similarity). Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase.
  • Sequence similarities

    Belongs to the ECSIT family.
  • Cellular localization

    Cytoplasm. Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134621.

References

ab134621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up