Description

  • Product name

    Recombinant Human EDA protein
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELE VLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYN TCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      245 to 391
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 100µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum. 0.1mg/ml after reconstitution.

General Info

  • Alternative names

    • ECTD1
    • Ectodermal dysplasia 1, anhidrotic
    • Ectodermal dysplasia protein
    • Ectodermal dysplasia, anhidrotic (hypohydrotic)
    • ECTODYSPLASIN
    • Ectodysplasin A
    • Ectodysplasin A, membrane form
    • Ectodysplasin A, secreted form
    • ECTODYSPLASIN A1 ISOFORM
    • ECTODYSPLASIN A2 ISOFORM
    • Ectodysplasin-A
    • ED1
    • ED1 A1
    • ED1 A2
    • ED1 GENE
    • eda
    • Eda A1
    • Eda A2
    • EDA protein
    • EDA protein homolog
    • EDA_HUMAN
    • EDA1
    • EDA1 GENE
    • EDA2
    • HED
    • HED1
    • ODT1
    • Oligodontia 1
    • secreted form
    • STHAGX1
    • Ta
    • Tabby
    • Tabby protein
    • X linked anhidroitic ectodermal dysplasia protein
    • XHED
    • XLHED
    see all
  • Function

    Seems to be involved in epithelial-mesenchymal signaling during morphogenesis of ectodermal organs. Isoform 1 binds only to the receptor EDAR, while isoform 3 binds exclusively to the receptor XEDAR.
  • Tissue specificity

    Not abundant; expressed in specific cell types of ectodermal (but not mesodermal) origin of keratinocytes, hair follicles, sweat glands. Also in adult heart, liver, muscle, pancreas, prostate, fetal liver, uterus, small intestine and umbilical chord.
  • Involvement in disease

    Defects in EDA are the cause of ectodermal dysplasia type 1 (ED1) [MIM:305100]; also known as Christ-Siemens-Touraine syndrome or X-linked hypohidrotic ectodermal dysplasia (XLHED). Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. ED1 is a disease characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands. ED1 is the most common form of over 150 clinically distinct ectodermal dysplasias.
    Defects in EDA are the cause of tooth agenesis selective X-linked type 1 (STHAGX1) [MIM:313500]. A form of selective tooth agenesis, a common anomaly characterized by the congenital absence of one or more teeth. Selective tooth agenesis without associated systemic disorders has sometimes been divided into 2 types: oligodontia, defined as agenesis of 6 or more permanent teeth, and hypodontia, defined as agenesis of less than 6 teeth. The number in both cases does not include absence of third molars (wisdom teeth).
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
    Contains 1 collagen-like domain.
  • Post-translational
    modifications

    N-glycosylated.
    Processing by furin produces a secreted form.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab157273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up