Recombinant Human EDA2R protein (denatured) (ab174561)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMDCQENEYWDQWGRCVTCQRCGPGQEL SKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTA TSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEA DAPTVPPQEAT
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 138
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • 9430060M22Rik
    • Ectodysplasin A2 isoform receptor
    • Ectodysplasin A2 receptor
    • EDA A2R
    • EDA-A2 receptor
    • EDA2R
    • EDAA2R
    • MGC124099
    • OTTMUSP00000019574
    • OTTMUSP00000019575
    • RP23-188N15.1
    • TNFRSF27
    • TNR27_HUMAN
    • Tumor necrosis factor receptor superfamily member 27
    • Tumor necrosis factor receptor superfamily member XEDAR
    • X linked ectodysplasin A2 receptor
    • X linked ectodysplasin receptor
    • X-linked ectodysplasin-A2 receptor
    • XEDAR
    see all
  • Function
    Receptor for EDA isoform A2, but not for EDA isoform A1. Mediates the activation of the NF-kappa-B and JNK pathways. Activation seems to be mediated by binding to TRAF3 and TRAF6.
  • Sequence similarities
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174561 (3 µg)

References

ab174561 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up