Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVP CPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYML ENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQH AHKELSGQGHLATAAAAFESRACSLEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGKHHHHHH
    • Molecular weight

      46 kDa including tags
    • Amino acids

      27 to 187
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_071731).

Specifications

Our Abpromise guarantee covers the use of ab233598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • Anhidrotic ectodysplasin receptor 1
    • DL
    • Downless (mouse) homolog
    • Downless homolog
    • Downless mouse homolog of
    • ECTD10A
    • ECTD10B
    • Ectodermal dysplasia receptor
    • Ectodysplasin 1 anhidrotic receptor
    • Ectodysplasin A receptor
    • Ectodysplasin A1 isoform receptor
    • Ectodysplasin-A receptor
    • ED 1R
    • ED 3
    • ED 5
    • ED1R
    • ED3
    • ED5
    • EDA 1R
    • EDA 3
    • EDA A1 receptor
    • EDA A1R
    • EDA-A1 receptor
    • EDA1R
    • EDA3
    • Edar
    • EDAR_HUMAN
    • HRM1
    • Tumor necrosis factor receptor superfamily member EDAR
    see all
  • Function

    Receptor for EDA isoform A1, but not for EDA isoform A2. Mediates the activation of NF-kappa-B and JNK. May promote caspase-independent cell death.
  • Tissue specificity

    Detected in fetal kidney, lung, skin and cultured neonatal epidermal keratinocytes. Not detected in lymphoblast and fibroblast cell lines.
  • Involvement in disease

    Defects in EDAR are a cause of ectodermal dysplasia anhidrotic (EDA) [MIM:224900]; also known ectodermal dysplasia hypohidrotic autosomal recessive (HED). Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EDA is characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands.
    Defects in EDAR are the cause of ectodermal dysplasia type 3 (ED3) [MIM:129490]; also known as ectodermal dysplasia hypohidrotic autosomal dominant or EDA3. ED3 is an autosomal dominant condition characterized by hypotrichosis, abnormal or missing teeth, and hypohidrosis due to the absence of sweat glands.
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Developmental stage

    Found in craniofacial tissues from embryonic day 42-53. Expressed in fetal skin 11 and 15 weeks after gestation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab233598.

    MW: 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab233598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up