Overview

  • Product name

    Recombinant Human EDC3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVP EVTFRAGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGT GKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKSYVDRHMESLS QSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIP DTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENI LESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLT LERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLP TSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVE QGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCK FVIPLHSA
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 508

Specifications

Our Abpromise guarantee covers the use of ab132637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EDC 3
    • edc3
    • EDC3_HUMAN
    • Enhancer of mRNA decapping 3 homolog
    • enhancer of mRNA decapping 3 homolog (S. cerevisiae)
    • Enhancer of mRNA decapping 3, S. cerevisiae, homolog of
    • Enhancer of mRNA decapping protein 3
    • Enhancer of mRNA-decapping protein 3
    • FLJ21128
    • FLJ31777
    • hYjeF_N2
    • hYjeF_N2-15q23
    • LSM 16
    • LSM16
    • LSM16 homolog
    • LSM16 homolog (EDC3 S. cerevisiae)
    • LSM16 homolog (EDC3, S. cerevisiae)
    • YJDC
    • YjeF domain containing
    • YjeF domain containing protein
    • YjeF domain containing protein 1
    • YjeF domain-containing protein 1
    • YjeF N-terminal domain-containing protein 2
    • YjeF_N2
    • YJEFN2
    see all
  • Function

    Binds single-stranded RNA. In the process of mRNA degradation, may play a role in mRNA decapping. May play a role in spermiogenesis and oogenesis.
  • Tissue specificity

    Expressed in theca and granulosa cells in ovary, and in spermatids of the meiotic division part II and apical membrane of Sertoli cells in testis (at protein level). Also expressed in brain and mammary gland.
  • Sequence similarities

    Belongs to the EDC3 family.
    Contains 1 DFDF domain.
    Contains 1 YjeF N-terminal domain.
  • Domain

    The DFDF domain is unstructured by itself. It assumes a helical fold upon interaction with DDX6.
  • Cellular localization

    Cytoplasm > P-body. Processing bodies.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132637 stained with Coomassie Blue.

References

ab132637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up