Overview

  • Product name

    Recombinant Human EDG6/S1PR4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALR GLSVAASCLVVLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYL ANVLLSGARTFRLAPAQWFLREGLLFTALAASTFSLLFTAGERFATMVRP VAESGATKTSRVYGFIGLCWLLAALLGMLPLLGWNCLCAFDRCSSLLPLY SKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRPAARRKARRLL KTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGAST TDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSI
    • Amino acids

      1 to 384
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as EDG6

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EDG6
    • Endothelial differentiation lysophosphatidic acid G protein coupled receptor 6
    • Endothelial differentiation G protein coupled receptor 6
    • Endothelial differentiation G-protein coupled receptor 6
    • Endothelial differentiation gene 6
    • LPC1
    • Lysophospholipid receptor C1
    • MGC129298
    • Putative G protein coupled receptor
    • S1P receptor 4
    • S1P receptor Edg-6
    • S1P receptor Edg6
    • S1P4
    • S1PR4
    • S1PR4_HUMAN
    • SLP4
    • Sphingosine 1 phosphate receptor 4
    • Sphingosine 1 phosphate receptor Edg6
    • Sphingosine 1-phosphate receptor 4
    • Sphingosine 1-phosphate receptor Edg-6
    see all
  • Function

    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. May be involved in cell migration processes that are specific for lymphocytes.
  • Tissue specificity

    Specifically expressed in fetal and adult lymphoid and hematopoietic tissue as well as in lung. Considerable level of expression in adult and fetal spleen as well as adult peripheral leukocytes and lung. Lower expression in adult thymus, lymph node, bone marrow, and appendix as well as in fetal liver, thymus, and lung.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab160145 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up