Description

  • Product name

    Recombinant Human EDG8 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI VLENLAVLLVLGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLT LKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARRGPAPVSSRGR TLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLA FVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALL RTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRR CLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      1 to 398

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EDG 8
    • EDG8 S1P receptor
    • Endothelial differentiation G protein coupled receptor 8
    • Endothelial differentiation G-protein-coupled receptor 8
    • Endothelial Differentiation Gene 8
    • Endothelial differentiation sphingolipid G protein coupled receptor 8
    • S1P receptor 5
    • S1P receptor Edg 8
    • S1P receptor Edg-8
    • S1P receptor Edg8
    • S1P5
    • S1PR5
    • S1PR5_HUMAN
    • Sphingosine 1 Phosphate Receptor 5
    • Sphingosine 1 phosphate receptor Edg 8
    • Sphingosine 1 phosphate receptor Edg8
    • Sphingosine 1-phosphate receptor 5
    • Sphingosine 1-phosphate receptor Edg-8
    • SPPR 1
    • SPPR 2
    • SPPR1
    • SPPR2
    see all
  • Function

    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). May play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
  • Tissue specificity

    Widely expressed in the brain, most prominently in the corpus callosum, which is predominantly white matter. Detected in spleen, peripheral blood leukocytes, placenta, lung, aorta and fetal spleen. Low-level signal detected in many tissue extracts. Overexpressed in leukemic large granular lymphocytes. Isoform 1 is predominantly expressed in peripheral tissues. Isoform 2 is expressed in brain, spleen and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Developmental stage

    At 24 weeks of gestation, fragments of radial glial fibers are positive within the cortical plate and subplate of allocortical areas. These positive fragments often appear enlarged as varicosities and some of them terminate at blood vessels. Between 28 and 30 weeks of gestation, all iso- and allocortical areas contain immunolabelled radial glial fibers revealing curvature next to sulci. After 32 weeks of gestation, radial glial fibers gradually disappear; instead positive transitional stages between radial glia and astrocytes were found.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132112, stained with Coomassie Blue.

References

ab132112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up