Description

  • Product name

    Recombinant Human eEF1A1/EF-Tu protein
    See all eEF1A1/EF-Tu proteins and peptides
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMG KGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIV GVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPL QDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK VTKSAQKAQKAK
    • Predicted molecular weight

      76 kDa including tags
    • Amino acids

      1 to 462
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      RRASVNSH = the linker region between the tag at the N terminus and the protein sequence.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab81792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.75% Potassium chloride, 0.0154% DTT, 0.316% Tris HCl, 0.00584% EDTA, 20% Glycerol

General Info

  • Alternative names

    • CCS 3
    • CCS3
    • Cervical cancer suppressor 3
    • chunp6927
    • CTCL tumor antigen
    • EE1A1
    • EEF 1
    • EEF1A
    • eEF1A-1
    • EEF1A1
    • EF-1-alpha-1
    • EF-Tu
    • EF1A
    • EF1a like protein
    • EF1A1_HUMAN
    • Elongation factor 1 alpha subunit
    • Elongation factor 1-alpha 1
    • Elongation factor Tu
    • Eukaryotic elongation factor 1 A-1
    • Eukaryotic translation elongation factor 1 alpha 1
    • Eukaryotic translation elongation factor 1 alpha 1 like 14
    • Glucocorticoid receptor AF 1 specific elongation factor
    • GRAF 1EF
    • HNGC:16303
    • ik:tdsubc_2a3
    • ik:tdsubc_2b3
    • LENG7
    • Leukocyte receptor cluster (LRC) member 7
    • Leukocyte receptor cluster member 7
    • Prostate tumor inducing protein 1
    • PTI1
    • tdsubc_2a3
    • Translation elongation factor 1 alpha 1 like 14
    • wu:fa91c07
    • wu:fa94b03
    • wu:fi13b09
    • xx:tdsubc_2a3
    • xx:tdsubc_2b3
    see all
  • Function

    This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
  • Tissue specificity

    Brain, placenta, lung, liver, kidney, pancreas but barely detectable in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab81792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.
The GST-EF1-alpha was folded natively and purified in water-soluble. It shall remain its activity although we have no specifically tested it.
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up