Recombinant Human eEF1A2 binding protein (ab164846)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPD LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP
    • Amino acids
      720 to 818
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434B1231
    • EEF1A2-binding protein 1
    • EEF1A2BP1
    • IGFN1
    • immunoglobulin like and fibronectin type III domain containing 1
    • KY interacting protein 1
    • KYIP1
    see all
  • Relevance
    eEF1A2 binding protein interacts with KY and with FLNC by similarity. Likely to be found in Z disc of striated muscle. There are 4 isoforms produced by alternative splicing.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab164846 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up