Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEV LARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRH GKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKD LKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETS MHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSR PKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPS RSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG QSGFFPLSYVEVLVPLPQ
    • Molecular weight

      68 kDa including tags
    • Amino acids

      1 to 368

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as SH3 containing Grb 2 like 1 protein

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CNSA1
    • EEN
    • EEN fusion partner of MLL
    • Endophilin-2
    • Endophilin-A2
    • Extra 11 19 leukemia fusion gene
    • Extra eleven-nineteen leukemia fusion gene protein
    • Fusion partner of MLL
    • MGC111371
    • SH3 containing Grb 2 like 1 protein
    • SH3 containing protein EEN
    • SH3 domain GRB2 like 1
    • SH3 domain protein 2B
    • SH3 domain-containing GRB2-like protein 1
    • SH3D2B
    • SH3G1_HUMAN
    • Sh3gl1
    • SH3P8
    see all
  • Function

    Implicated in endocytosis. May recruit other proteins to membranes with high curvature.
  • Tissue specificity

    Ubiquitous. Higher expression in pancreas, placenta, prostate, testis and uterus.
  • Involvement in disease

    Note=In some cases of acute leukemia, a translocation results in the formation of a MLL-EEN fusion gene.
  • Sequence similarities

    Belongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Domain

    An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.
  • Cellular localization

    Cytoplasm. Early endosome membrane. Associated with postsynaptic endosomes in hippocampal neurons.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132998 stained with Coomassie Blue.

References

ab132998 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up