Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKA AKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALG TMMHCQTLKDQPSAYSKVQWLTPVNLALWEAEAGGSLEGFLNSSELSGLP AGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQS PSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDD EPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAE TE
    • Molecular weight

      33 kDa
    • Amino acids

      46 to 346
    • Additional sequence information

      NP_005717.2

Specifications

Our Abpromise guarantee covers the use of ab181937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 2.4% Urea, 0.32% Tris HCl

General Info

  • Alternative names

    • COXPD 3
    • COXPD3
    • EF TS
    • EF Tsmt
    • EF-Ts
    • EF-TsMt
    • EFTS
    • EFTS_HUMAN
    • EFTSMT
    • Elongation factor Ts
    • Elongation factor Ts mitochondrial
    • HGNC12367
    • mitochondrial
    • Mitochondrial elongation factor Ts
    • Ts translation elongation factor mitochondrial
    • TSFM
    • TSMT
    see all
  • Function

    Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.
  • Tissue specificity

    Expressed in all tissues, with the highest levels of expression in skeletal muscle, liver and kidney.
  • Involvement in disease

    Defects in TSFM are the cause of combined oxidative phosphorylation deficiency type 3 (COXPD3) [MIM:610505]. Defects in the mitochondrial oxidative phosphorylation system result in devastating, mainly multisystem, diseases. COXPD3 symptoms include severe metabolic acidosis with encephalomyopathy or with hypertrophic cardiomyopathy. Patients show a severe defect in mitochondrial translation leading to a failure to assemble adequate amounts of three of the oxidative phosphorylation complexes.
  • Sequence similarities

    Belongs to the EF-Ts family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab181937.

References

ab181937 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181937.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up