

  • Nature
  • Source
  • Amino Acid Sequence
    • Species
    • Tags
      His tag C-Terminus


Our Abpromise guarantee covers the use of ab51961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications


  • Purity
    > 95 % SDS-PAGE.
    >98% by SDS-PAGE and HPLC analyses Endotoxin level is <0.1 ng per µg.
  • Form
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituents: 0.1% BSA, PBS

  • Reconstitution
    Reconstitute in sterile PBS to a concentration of 0.1-1.0 mg/ml containing 0.1% BSA. This solution can then be diluted into other aqueous buffers.

General Info

  • Alternative names
    • Black mamba toxin related protein
    • EG VEGF
    • EG-VEGF
    • EGVEGF
    • Endocrine-gland-derived vascular endothelial growth factor
    • Mambakine
    • PK1
    • PRK1
    • PROK1
    • Prokineticin 1
    • Prokineticin-1
    see all
  • Function
    Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis.
  • Tissue specificity
    Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic glands, ovary, testis, adrenal and placenta.
  • Sequence similarities
    Belongs to the AVIT (prokineticin) family.
  • Developmental stage
    In adult testis, is strongly expressed only in Leydig cells. In testicular tumors, expressed specifically in Leydig cell tumors (at protein level). Expressed from 14 weeks until birth in fetal testis.
  • Cellular localization
  • Information by UniProt


ab51961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As


Thank you for your enquiry and your interest in our products. Here is the rhEG-VEGF protein sequence: AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCP CLPNLLCSRFPDGRYRCSMDLKNINF I hope this information will be useful for you.

Read More


Sign up