For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-eg-vegf-protein-animal-free-ab242435.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones Hormones
Share by email

Recombinant Human EG-VEGF protein (Animal Free) (ab242435)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human EG-VEGF protein (Animal Free) (ab242435)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Suitable for: SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human EG-VEGF ELISA Kit (PK1) (ab119591)

    View more associated products

    Description

    • Product name

      Recombinant Human EG-VEGF protein (Animal Free)
      See all EG-VEGF proteins and peptides
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      Escherichia coli
    • Accession

      P58294
    • Protein length

      Full length protein
    • Animal free

      Yes
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPF FRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
      • Predicted molecular weight

        10 kDa
      • Amino acids

        20 to 105
      • Additional sequence information

        This product is the mature full length protein from aa 20 to 105. The signal peptide is not included.

    Associated products

    • Related Products

      • Anti-EG-VEGF antibody [EPR9699] (ab150375)

    Specifications

    Our Abpromise guarantee covers the use of ab242435 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C.

      Constituent: 0.1% Trifluoroacetic acid

      0.2 micron filtered.

    • Reconstitution
      Reconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C, and avoid repeat freeze thaws.

    General Info

    • Alternative names

      • Black mamba toxin related protein
      • EG VEGF
      • EG-VEGF
      • EGVEGF
      • Endocrine-gland-derived vascular endothelial growth factor
      • Mambakine
      • PK1
      • PRK1
      • PROK1
      • PROK1_HUMAN
      • Prokineticin 1
      • Prokineticin-1
      see all
    • Function

      Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis.
    • Tissue specificity

      Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic glands, ovary, testis, adrenal and placenta.
    • Sequence similarities

      Belongs to the AVIT (prokineticin) family.
    • Developmental stage

      In adult testis, is strongly expressed only in Leydig cells. In testicular tumors, expressed specifically in Leydig cell tumors (at protein level). Expressed from 14 weeks until birth in fetal testis.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P58294 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human EG-VEGF protein (Animal Free) (ab242435)
      SDS-PAGE - Recombinant Human EG-VEGF protein (Animal Free) (ab242435)

      1 µg ab242435 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

      Lane 1: Non-reducing conditions.

      Lane 2: Reducing conditions.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab242435? Please let us know so that we can cite the reference in this datasheet.

    ab242435 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242435.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.