Recombinant Human EG-VEGF protein (Animal Free) (ab242435)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human EG-VEGF protein (Animal Free)
See all EG-VEGF proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPF FRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF -
Predicted molecular weight
10 kDa -
Amino acids
20 to 105 -
Additional sequence information
This product is the mature full length protein from aa 20 to 105. The signal peptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab242435 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
0.2 micron filtered. -
ReconstitutionReconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C, and avoid repeat freeze thaws.
General Info
-
Alternative names
- Black mamba toxin related protein
- EG VEGF
- EG-VEGF
see all -
Function
Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis. -
Tissue specificity
Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic glands, ovary, testis, adrenal and placenta. -
Sequence similarities
Belongs to the AVIT (prokineticin) family. -
Developmental stage
In adult testis, is strongly expressed only in Leydig cells. In testicular tumors, expressed specifically in Leydig cell tumors (at protein level). Expressed from 14 weeks until birth in fetal testis. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab242435 has not yet been referenced specifically in any publications.