Overview

  • Product name

    Recombinant Human EGR4 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLT THVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGF YSLGLSFASL
    • Amino acids

      377 to 486
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AT133
    • Early growth response protein 4
    • Nerve growth factor induced clone C
    • NGFI C
    • NGFIC
    • PAT133
    see all
  • Relevance

    EGR4(Early Growth Response protein 4) is a zinc-finger transcription factor that activates the transcription of genes whose products are required for mitogenesis and differentiation. EGR4 is closely related to nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR4 functionally cooperate with NFAT proteins and induce expression of IL2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
  • Cellular localization

    Nuclear

Images

  • ab158339 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up