Overview

  • Product name

    Recombinant Human EHD2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPAL EDADFDGKPMVLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAV MHGDTEGTVPGNALVVDPDKPFRKLNPFGNTFLNRFMCAQLPNQVLESIS IIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEF SEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVL RVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISP GDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQE ELESTEVGVQGGAFEGTHMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDK SKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGM LDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE
    • Molecular weight

      88 kDa including tags
    • Amino acids

      1 to 543

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EH domain containing 2
    • EH domain containing 3
    • EH domain containing protein 2
    • EH domain-containing protein 2
    • EHD 2
    • Ehd2
    • EHD2_HUMAN
    • EHD3
    • FLJ96617
    • PAST 2
    • PAST homolog 2
    • PAST2
    see all
  • Function

    Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.
  • Tissue specificity

    Highly expressed in heart and moderately expressed in placenta, lung, and skeletal muscle.
  • Sequence similarities

    Contains 1 EF-hand domain.
    Contains 1 EH domain.
  • Domain

    The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins.
  • Cellular localization

    Cell membrane. Endosome membrane. Colocalizes with GLUT4 in intracellular tubulovesicular structures that are associated with cortical F-actin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132288.

References

ab132288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up