Description

  • Product name

    Recombinant human EHMT2/G9A protein
    See all EHMT2/G9A proteins and peptides
  • Biological activity

    Specific Activity: ≥70 pmol/min/µg

     

    Assay conditions: 50 μl reaction mix (50 mM TRIS pH 8.8, 5mM MgCl2, 4mM DTT, 0.05% Tween-20, 40 μM S-adenosylmethionine, and ab198156  (0.05 – 0.5 ng) add to the wells coated with the substrate on a Neutravidin black plate. Incubate for 1 hr. Add antibody against methylated K9 residue of histone H3, incubate 1 hr. Then, add secondary HRP- labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Purity

    >= 50 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIA EVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEG DTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVP IPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSN CLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQS GIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDS YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFP RIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIAL EQSRLARLDPHPELLPELGS LPPVNT
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      785 to 1210
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_006709

Specifications

Our Abpromise guarantee covers the use of ab198156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab198156 is useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.05% DTT, 0.02% Potassium chloride, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Ankyrin repeat containing protein
    • Bat 8
    • Bat8
    • C6orf30
    • DKFZp686H08213
    • EHMT 2
    • Ehmt2
    • EHMT2_HUMAN
    • Euchromatic histone lysine methyltransferase 2
    • Euchromatic histone lysine N methyltransferase 2
    • Euchromatic histone-lysine N-methyltransferase 2
    • FLJ35547
    • G 9a
    • G9 a
    • G9A
    • G9a protein
    • G9A histone methyltransferase
    • GAT8
    • H3 K9 HMTase 3
    • H3-K9-HMTase 3
    • Histone H3 K9 methyltransferase 3
    • Histone H3 K9 methyltransferase3
    • Histone H3-K9 methyltransferase 3
    • Histone lysine N methyltransferase
    • Histone lysine N methyltransferase EHMT2
    • Histone lysine N methyltransferase, H3 lysine 9 specific 3
    • Histone lysine N methyltransferase, H3 lysine 9 specific3
    • Histone-lysine N-methyltransferase EHMT2
    • HLA B associated transcript 8
    • HLA-B-associated transcript 8
    • KMT 1C
    • KMT1 C
    • Lysine N methyltransferase 1C
    • Lysine N-methyltransferase 1C
    • NG 36
    • NG36
    • Protein G9a
    see all
  • Function

    Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and itself.
  • Tissue specificity

    Expressed in all tissues examined, with high levels in fetal liver, thymus, lymph node, spleen and peripheral blood leukocytes and lower level in bone marrow.
  • Sequence similarities

    Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. Suvar3-9 subfamily.
    Contains 7 ANK repeats.
    Contains 1 post-SET domain.
    Contains 1 pre-SET domain.
    Contains 1 SET domain.
  • Domain

    The SET domain mediates interaction with WIZ.
    The ANK repeats bind H3K9me1 and H3K9me2.
  • Post-translational
    modifications

    Methylated at Lys-185; automethylated.
  • Cellular localization

    Nucleus. Chromosome. Associates with euchromatic regions. Does not associate with heterochromatin.
  • Information by UniProt

Images

  • Specific activity analysis for ab198156.

  • 10% SDS-PAGE analysis of 5 μg of ab198156, with Coomassie staining.

References

ab198156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up