Description

  • Product name

    Recombinant Human EI24 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLA QRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSV TARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIA DLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVG QLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLA FLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATSGH
    • Amino acids

      1 to 340
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ectopic P granules autophagy protein 4 homolog
    • Ei24
    • EI24_HUMAN
    • EPG4
    • Etoposide induced 2.4 mRNA
    • Etoposide-induced protein 2.4 homolog
    • p53-induced gene 8 protein
    • PIG8
    • TP53I8
    • Tumor protein p53 inducible protein 8
    see all
  • Function

    Acts as a negative growth regulator via p53-mediated apoptosis pathway. Regulates formation of degradative autolysosomes during autophagy.
  • Involvement in disease

    Note=EI24 is on a chromosomal region frequently deleted in solid tumors, and it is thought to play a role in breast and cervical cancer. Particularly, expression analysis of EI24 in cancerous tissues shows that EI24 loss is associated with tumor invasiveness.
  • Sequence similarities

    Belongs to the EI24 family.
  • Cellular localization

    Nucleus membrane. Cytoplasm. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab160539 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up