Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYC VRQNREDIVSSANNSLTEALEEANVLFDGVSRTREAALDARFLVMASDLG KEKAKQLNSDMNFFNQLAFCDFLFLFVGLNWMEGDPDKLSDCDDSIALSF WKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGN MPTKLQKLDLSSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPN SFSRTVENIFYVSFIVRDGFARIRLDEDRLPILEPMNVNQMGEGNDSSCH GRKQGVISLTLQEWKNIVAAFEISEAMITYSSY
    • Molecular weight

      65 kDa including tags
    • Amino acids

      1 to 333

Specifications

Our Abpromise guarantee covers the use of ab132909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E1A-like inhibitor of differentiation 3
    • EID 3
    • EID-1-like inhibitor of differentiation 3
    • EID-3
    • EID3
    • EID3_HUMAN
    • EP300 interacting inhibitor of differentiation 3
    • EP300-interacting inhibitor of differentiation 3
    • FLJ25832
    • Non-SMC element 4, S. cerevisiae, homolog of, B
    • Non-structural maintenance of chromosomes element 4 homolog B
    • NSE4B
    • NSMCE4B
    see all
  • Function

    Act as a repressor of nuclear receptor-dependent transcription possibly by interfering with CREBBP-dependent coactivation. May function as a coinhibitor of other CREBBP/EP300-dependent transcription factors.
  • Tissue specificity

    Highly expressed in testis.
  • Sequence similarities

    Belongs to the NSE4 family.
  • Cellular localization

    Nucleus. Cytoplasm. May shuttle between nucleus and cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132909, stained with Coomassie Blue.

References

ab132909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up