Description

  • Product name

    Recombinant Human eIF-6 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVH ASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEER LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS YCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN DWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      1 to 245

Specifications

Our Abpromise guarantee covers the use of ab132440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.

    Previously labelled as Integrin beta 4 binding protein. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • b(2)gcn
    • B(2)GCN homolog
    • B4 integrin interactor
    • Binding protein of beta-4 integrin
    • CAB
    • eIF-6
    • EIF3A
    • EIF6
    • Eukaryotic translation initiation factor 3A
    • Eukaryotic translation initiation factor 6
    • IF6_HUMAN
    • Integrin beta 4 binding protein
    • ITGB4BP
    • OK/SW-cl.27
    • p27 beta 4 integrin binding protein
    • p27(BBP)
    • p27BBP
    • RP4-614O4.1
    see all
  • Function

    Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May behave as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (GNB2L1)-dependent protein kinase C activity.
  • Tissue specificity

    Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level).
  • Sequence similarities

    Belongs to the eIF-6 family.
  • Post-translational
    modifications

    Phosphorylation at Ser-174 and Ser-175 promotes nuclear export.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Shuttles between cytoplasm and nucleus/nucleolus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132440 stained with Coomassie Blue.

References

ab132440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Other
The effect of recombinant protein on cell viability is assessed using MTS viability determination method on cultured CHO-M2 cells incubated 42h in presence of different concentrations (163 – 45.5 – 22.7 – 11.4 – 5.7 – 2.8 – 1.4 nM) of rITGB4bp.

CONCLUSION
The viability is similar for the different concentration of rITGB4bp. It doesn’t affect cell viability.

Abcam user community

Verified customer

Submitted Aug 26 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up