Description

  • Product name

    Recombinant Human EIF1AY protein
  • Purity

    > 95 % SDS-PAGE.
    ab103788 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELV FKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDD EIQFDDIGDDDEDIDDI
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 144
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • eIF 1A Y isoform
    • eIF 4C
    • eIF-1A Y isoform
    • EIF-4C
    • EIF1AY
    • Eukaryotic translation initiation factor 1A
    • Eukaryotic translation initiation factor 1A, Y chromosomal
    • Eukaryotic translation initiation factor 1A, Y linked
    • Eukaryotic translation initiation factor 4C
    • IF1AY_HUMAN
    • Y-chromosomal
    see all
  • Function

    Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the eIF-1A family.
    Contains 1 S1-like domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103788.

References

ab103788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up