Overview

  • Product name

    Recombinant Human eIF2B3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEE VIVVTTRDVQKALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTD VLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKK AVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLV DAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKE EDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKH LVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEE GSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLM EI
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 452

Specifications

Our Abpromise guarantee covers the use of ab132469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EI2BG_HUMAN
    • EIF 2B
    • eIF 2B GDP GTP exchange factor subunit gamma
    • eIF-2B GDP-GTP exchange factor subunit gamma
    • eIF2B-gamma
    • Eif2b3
    • EIF2Bgamma
    • Eukaryotic translation initiation factor 2B subunit 3 gamma
    • Eukaryotic translation initiation factor 2B, gamma
    • eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
    • OTTHUMP00000010262
    • OTTHUMP00000010263
    • Translation initiation factor eIF-2B subunit gamma
    see all
  • Function

    Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
  • Involvement in disease

    Defects in EIF2B3 are a cause of leukodystrophy with vanishing white matter (VWM) [MIM:603896]. VWM is a leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy.
  • Sequence similarities

    Belongs to the eIF-2B gamma/epsilon subunits family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132469 on a 12.5% gel stained with Coomassie Blue.

References

ab132469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up