Overview

  • Product name

    Recombinant Human eIF3A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPI MLKYLELCVDLRKSHLAKEGLYQYK
    • Amino acids

      1 to 75
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • centrosomin homolog
    • cytoplasmic protein p167
    • eIF 3 theta
    • eIF-3-theta
    • EIF3
    • eIF3 p167
    • eIF3 p170
    • eIF3 p180
    • EIF3 p180 subunit
    • eIF3 p185
    • eIF3 theta
    • eIF3a
    • EIF3A_HUMAN
    • EIF3S10
    • Eukaryotic translation initiation factor 3 subunit 10
    • eukaryotic translation initiation factor 3 subunit 10 (theta 150 170kD)
    • eukaryotic translation initiation factor 3 subunit 10 (theta 170kD)
    • eukaryotic translation initiation factor 3 subunit 10 170kDa
    • eukaryotic translation initiation factor 3 subunit 10 theta 150 170kDa
    • Eukaryotic translation initiation factor 3 subunit A
    • OTTHUMP00000020589
    • P167
    • p180
    • p185
    • TIF32
    see all
  • Function

    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Essential for the initiation of translation on type-1 viral ribosomal entry sites (IRESs), like for HCV, PV, EV71 or BEV translation (PubMed:23766293, PubMed:24357634). In case of FCV infection, plays a role in the ribosomal termination-reinitiation event leading to the translation of VP2 (PubMed:18056426).
  • Sequence similarities

    Belongs to the eIF-3 subunit A family.
    Contains 1 PCI domain.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation is enhanced upon serum stimulation.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab152903 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up