Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKN DKAKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP MWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVC GAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSH ADTATKSGSTTKNRFVV
    • Molecular weight
      28 kDa
    • Amino acids
      1 to 217
    • Modifications
      mutated S53 A

Specifications

Our Abpromise guarantee covers the use of ab176929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 0.79% Tris HCl, 0.11% Beta mercaptoethanol, 0.012% Benzamidine, 0.002% PMSF, 0.03% EDTA, 10% Glycerol

General Info

  • Alternative names
    • AUTS19
    • CBP
    • eIF 4E
    • EIF 4F
    • eIF 4F 25 kDa subunit
    • eIF-4E
    • eIF-4F 25 kDa subunit
    • eIF4E
    • EIF4E1
    • EIF4EL1
    • EIF4F
    • Eukaryotic translation initiation factor 4 E
    • Eukaryotic translation initiation factor 4E
    • Eukaryotic translation initiation factor 4E like 1
    • IF4E_HUMAN
    • Messanger RNA Cap Binding Protein eIF 4E
    • MGC111573
    • mRNA cap binding protein
    • mRNA cap-binding protein
    see all
  • Function
    Its translation stimulation activity is repressed by binding to the complex CYFIP1-FMR1 (By similarity). Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates the binding to the mRNA cap.
  • Sequence similarities
    Belongs to the eukaryotic initiation factor 4E family.
  • Post-translational
    modifications
    Phosphorylation increases the ability of the protein to bind to mRNA caps and to form the eIF4F complex.
  • Information by UniProt

References

ab176929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up