Overview

  • Product name

    Recombinant Human eIF4G1 protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      IEEYLHLNDMKEAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQ LLHQLLCAGHLSTAQYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQ EGGVPMGELFREITKPLRPLGKAASLLLEILGLLCKSMGPKKVGTLWREA GLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELNRQLEK LLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRV DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDAL YDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
    • Molecular weight

      47 kDa including tags
    • Amino acids

      1250 to 1599
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged

Specifications

Our Abpromise guarantee covers the use of ab235068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • DKFZp686A1451
    • eIF 4 gamma 1
    • eIF 4G 1
    • eIF 4G1
    • eIF-4-gamma 1
    • eIF-4G 1
    • eIF-4G1
    • EIF4 gamma
    • EIF4F
    • EIF4G
    • EIF4G1
    • EIF4GI
    • Eukaryotic translation initiation factor 4 gamma 1
    • IF4G1_HUMAN
    • p220
    see all
  • Function

    Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome.
  • Involvement in disease

    Defects in EIF4G1 are the cause of Parkinson disease type 18 (PARK18) [MIM:614251]. An autosomal dominant, late-onset form of Parkinson disease. Parkinson disease is a complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain.
  • Sequence similarities

    Belongs to the eIF4G family.
    Contains 1 MI domain.
    Contains 1 MIF4G domain.
    Contains 1 W2 domain.
  • Post-translational
    modifications

    Phosphorylated at multiple sites in vivo. Phosphorylation at Ser-1185 by PRKCA induces binding to MKNK1.
    Following infection by certain enteroviruses, rhinoviruses and aphthoviruses, EIF4G1 is cleaved by the viral protease 2A, or the leader protease in the case of aphthoviruses. This shuts down the capped cellular mRNA transcription.
  • Information by UniProt

Images

  • ab235068 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up