Overview

  • Product name

    Recombinant Human eIF4GII protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNSQPQTRSPFAAGPRPPHHQFFQRPQIQPPRATIPNSSPSIRPGAQTPT AVYQANQHIMMVNHLPMPYPVPQGPQYCIPQYRHSGPPYVGPPQQYPVQP PGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQSAPIMVPTQQQPPPAKREK KTIRIRDPNQGGKDITEEIISGGGSRNPTPPIGRPTSTPTPPQQLPSQVP EHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVL SGEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAAPTSSALSS QPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDGDICKKP CSVAPNDIPLVSSTNLINEINGVSEKLSATESIVEIVKQEVLPLTLELEI LENPPEEMKLECIPAPITPSTVPSFPPTPPTPPASPPHTPVIVPAAATTV SSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQTEEILDSQN LNSRRSPVPETSNEC
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 515

Specifications

Our Abpromise guarantee covers the use of ab132478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • eIF-4-gamma 3
    • eIF-4-gamma II
    • eIF-4G 3
    • eIF4G 3
    • EIF4G3
    • eIF4GII
    • Eukaryotic translation initiation factor 4 gamma 3
    • eukaryotic translation initiation factor 4 gamma, 3
    • eukaryotic translation initiation factor-4 gamma, 3
    • IF4G3_HUMAN
    see all
  • Function

    Probable component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome. Thought to be a functional homolog of EIF4G1.
  • Sequence similarities

    Belongs to the eukaryotic initiation factor 4G family.
    Contains 5 HEAT repeats.
    Contains 1 MI domain.
    Contains 1 MIF4G domain.
    Contains 1 W2 domain.
  • Post-translational
    modifications

    Following infection by certain enteroviruses, rhinoviruses and aphthoviruses, EIF4G1 is cleaved by the viral protease 2A, or the leader protease in the case of aphthoviruses. This shuts down the capped cellular mRNA transcription.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132478 stained with Coomassie Blue

References

ab132478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up