Description

  • Product name

    Recombinant Human eIF5A protein
    See all eIF5A proteins and peptides
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK HGHA KVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGY LSLLQDSGEV REDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAA VAIKAMAK
    • Amino acids

      1 to 154

Specifications

Our Abpromise guarantee covers the use of ab91910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 0.5% Thiourea, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 67 µl aqua dest.

General Info

  • Alternative names

    • eIF 4D
    • EIF 5A
    • eIF 5A 1
    • eIF 5A1
    • eIF-4D
    • eIF-5A
    • eIF-5A-1
    • eIF-5A1
    • eIF4D
    • eif5a
    • EIF5A1
    • eIF5AI
    • Eukaryotic initiation factor 5A
    • Eukaryotic initiation factor 5A isoform 1
    • Eukaryotic translation initiation factor 5A
    • Eukaryotic translation initiation factor 5A 1
    • Eukaryotic translation initiation factor 5A-1
    • IF5A1_HUMAN
    • MGC104255
    • MGC99547
    • Rev binding factor
    • Rev-binding factor
    • uORF
    • uORF A
    see all
  • Function

    mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
  • Tissue specificity

    Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
  • Sequence similarities

    Belongs to the eIF-5A family.
  • Post-translational
    modifications

    eIF-5A seems to be the only eukaryotic protein to have an hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine).
  • Cellular localization

    Cytoplasm. Nucleus. Endoplasmic reticulum membrane. Nucleus > nuclear pore complex. Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up