Description

  • Product name

    Recombinant Human eIF5A2 protein
  • Purity

    >= 85 % SDS-PAGE.
    ab99140 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGF VVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMD VPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAG EDVQVSVMCAMSEEYAVAIKPCK
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 153
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 9630038B20
    • eIF 5A 2
    • eIF 5A2
    • eIF-4D
    • eIF-5A-2
    • eIF-5A2
    • EIF5A 2
    • EIF5A2
    • eIF5AII
    • Eukaryotic initiation factor 5A isoform 2
    • Eukaryotic translation initiation factor 5A-2
    • Eukaryotic translation initiation factor 5A2
    • IF5A2_HUMAN
    see all
  • Function

    mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation.
  • Tissue specificity

    Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
  • Sequence similarities

    Belongs to the eIF-5A family.
  • Post-translational
    modifications

    eIF-5A seems to be the only eukaryotic protein to have an hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine).
  • Cellular localization

    Cytoplasm. Nucleus. Endoplasmic reticulum membrane. Nucleus > nuclear pore complex. Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99140

References

ab99140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up