Description

  • Product name

    Recombinant Human ELAC2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MWALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSG CSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKL KVARLDNIFLTRMHWSNVGGLSGMILTLKETGLPKCVLSGPPQLEKYLEA IKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSP ERPLSRLSPERSSDSELNENEPHLPHGVSQRRGVRDSSLVVAFICKLHLK RGNFLVLKAKEMGLPVGTAAIAPIIAAVKDGKSITHEGREILAEELCTPP DPGAAFVVVECPDESFIQPICENATFQRYQGKADAPVALVVHMAPASVLV DSRYQQWMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLL TSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEA LQLPNFQQSVQEYRRSAQDGPAPAEKRSQYPEIIFLGTGSAIPMKIRNVS ATLVNISPDTSLLLDCGEGTFGQLCRHYGDQVDRVLGTLAAVFVSHLHAD HHTGLPSILLQRERALASLGKPLHPLLVVAPNQLKAWLQQYHNQCQEVLH HISMIPAKCLQEGAEISSPAVERLISSLLRTCDLEEFQTCLVRHCKHAFG CALVHTSGWKVVYSGDTMPCEALVRMGKDATLLIHEATLEDGLEEEAVEK THSTTSQAISVGMRMNAEFIMLNHFSQRYAKVPLFSPNFSEKVGVAFDHM KVCFGDFPTMPKLIPPLKALFAGDIEEMEERREKRELRQVRAALLSRELA GGLEDGEPQQKRAHTEEPQAKKVRAQ
    • Amino acids

      1 to 826
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COXPD17
    • elaC homolog 2 (E. coli)
    • ElaC homolog protein 2
    • elaC ribonuclease Z 2
    • elaC, E. coli, homolog of, 2
    • ELAC2
    • ELC2
    • FLJ10530
    • FLJ36693
    • FLJ42848
    • Heredity prostate cancer protein 2
    • HPC2
    • putative prostate cancer susceptibility protein HPC2/ELAC2
    • Ribonuclease Z 2
    • Ribonuclease Z, long form
    • Ribonuclease Z2
    • RNase Z 2
    • RNase Z2
    • RNase ZL
    • RNZ2_HUMAN
    • tRNA 3 endonuclease 2
    • tRNase Z (long form)
    • tRNase Z 2
    • tRNase Z2
    • Zinc phosphodiesterase ELAC protein 2
    see all
  • Function

    Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
  • Tissue specificity

    Widely expressed. Highly expressed in heart, placenta, liver, skeletal muscle, kidney, pancreas, testis and ovary. Weakly expressed in brain, lung, spleen, thymus, prostate, small intestine, colon and leukocytes.
  • Involvement in disease

    Defects in ELAC2 may be a cause of susceptibility to prostate cancer (PC) [MIM:176807]. It is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
  • Sequence similarities

    Belongs to the RNase Z family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab163728 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up