Description

  • Product name

    Recombinant Human Elafin/ESI protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by reducing SDS-PAGE. ab153768 is supplied as a 0.2 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK PGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
    • Predicted molecular weight

      10 kDa
    • Amino acids

      23 to 117
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Elafin/Skalp. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • Cementoin
    • ELAF_HUMAN
    • Elafin
    • Elafin/Skalp
    • Elastase Specific Inhibitor
    • Elastase-specific inhibitor
    • ES 1
    • ESI
    • Peptidase inhibitor 3
    • Peptidase inhibitor 3, skin derived
    • PI 3
    • PI-3
    • PI3
    • Pre elafin
    • Protease inhibitor 3 skin derived
    • Protease inhibitor 3, skin derived (SKALP)
    • Protease inhibitor WAP3
    • SKALP
    • Skin derived Anti leukoproteinase
    • Skin-derived antileukoproteinase
    • Trappin 2
    • WAP four disulfide core domain 14
    • WAP four disulfide core domain protein 14
    • WAP four-disulfide core domain protein 14
    • WAP3
    • WFDC14
    see all
  • Function

    Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
  • Sequence similarities

    Contains 1 WAP domain.
  • Domain

    Consists of two domains: the transglutaminase substrate domain (cementoin moiety) and the elastase inhibitor domain. The transglutaminase substrate domain serves as an anchor to localize elafin covalently to specific sites on extracellular matrix proteins.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab153768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up