Description

  • Product name

    Recombinant Human ELF2/NERF protein
  • Purity

    > 90 % SDS-PAGE.
    refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGEFELATSLHEGPTNQLDLLIRAVE ASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEF IHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPK TQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWT QREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVE GQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLL KAASSVRSGKNSSPINCSRAEKGVARVVNITSPGHDASSRSPTTTASVSA TAAPRTVRVAMQVPVVMTSLGQKISTVAVQSVNAGAPLITSTSPTTATSP KVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGS GSINIVGTPLAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIK GPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPV TMKTEGLVTCEK
    • Predicted molecular weight

      64 kDa
    • Amino acids

      1 to 533
    • Additional sequence information

      Isoform 3 with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab204210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as ELF2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names

    • E74 like factor 2
    • E74 like factor 2 ets domain transcription factor
    • ELF 2
    • Ets domain transcription factor
    • Ets related factor
    • ETS related transcription factor Elf 2
    • ETS related transcription factor Elf2
    • EU 32
    • EU32
    • HGNC:3317
    • NERF
    • NERF 1A
    • NERF 1a b
    • NERF 1B
    • NERF 2
    • NERF1A
    • NERF1a b
    • NERF1B
    • NERF2
    • New ETS related factor
    see all
  • Relevance

    The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1 mediated transcription of the B cell specific blk gene.
  • Cellular localization

    Nuclear

References

ab204210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up