Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSI LHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
    • Molecular weight

      36 kDa
    • Amino acids

      1 to 92

Specifications

Our Abpromise guarantee covers the use of ab132224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cast 2
    • CAST2
    • CAZ associated structural protein 2
    • Elks
    • ELKS/RAB6 interacting/CAST family member 1
    • ELKS/RAB6-interacting/CAST family member 1
    • ERC 1
    • ERC protein 1
    • ERC-1
    • Erc1
    • ERC1 protein
    • KIAA1081
    • MGC12974
    • RAB6 interacting protein 2
    • RAB6-interacting protein 2
    • RAB6IP2
    • RB6I2_HUMAN
    see all
  • Function

    Regulatory subunit of the IKK complex. Probably recruits IkappaBalpha/NFKBIA to the complex. May be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. May be involved in vesicle trafficking at the CAZ. May be involved in Rab-6 regulated endosomes to Golgi transport.
  • Tissue specificity

    Widely expressed. Isoform 2 and isoform 4 are abundantly expressed in brain. Isoform 1 and isoform 3 are predominantly expressed in testis and thyroid, and isoform 1 predominates in other tissues tested.
  • Involvement in disease

    Thyroid papillary carcinoma (TPC) [MIM:188550]: A common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=The gene represented in this entry may be involved in disease pathogenesis. A chromosomal aberration involving ERC1/RAB6IP2 is found in cause of thyroid papillary carcinomas. Translocation t(10;12)(q11;p13) involving RET. In vitro, isoform 1, isoform 3 and isoform 5 participating in a ERC1-RET fusion protein activate tyrosine-protein kinase activity.
  • Sequence similarities

    Contains 1 FIP-RBD domain.
  • Cellular localization

    Cytoplasm. Membrane. Golgi apparatus membrane. In neurons, localized closed to presynaptic membrane. Recruited on Golgi membranes by RAB6A in a GTP-dependent manner.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132224 stained with Coomassie Blue.

References

ab132224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up