Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFA LQHADSSNFYITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAK LEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPC FGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQR SLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINAL FLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVL ENSSREDKHECPFGRSSIELTKMLCEILKVGELPSETCNDFHPMFFTHDR SFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMRALTTKPSSLD QFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQ QRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNC QLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD LENIQIPDAPPPIPKEPSNYDFVYDCN
    • Molecular weight

      110 kDa including tags
    • Amino acids

      1 to 727

Specifications

Our Abpromise guarantee covers the use of ab131839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CED 12
    • Ced 12 homolog
    • Ced 12 homolog 1
    • CED-12
    • CED12
    • Ced12 homolog
    • Ced12 homolog 1
    • ELMO 1
    • ELMO-1
    • Elmo1
    • ELMO1_HUMAN
    • Engulfment and cell motility 1
    • Engulfment and cell motility protein 1
    • KIAA0281
    • MGC126406
    • Protein ced-12 homolog
    see all
  • Function

    Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.
  • Tissue specificity

    Widely expressed, with a higher expression in the spleen and placenta.
  • Sequence similarities

    Contains 1 ELMO domain.
    Contains 1 PH domain.
  • Post-translational
    modifications

    Phosphorylated by HCK.
  • Cellular localization

    Cytoplasm. Cell membrane. Translocation to plasma membrane seems to be mediated by DOCK1 and CRK.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131839 stained with Coomassie Blue.

References

ab131839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up