Overview

  • Product name

    Recombinant Human ELMO2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTK LLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVS ILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIAL INALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYV LQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNAPGSGT EKRKAMYTKDYKMLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTY IRIVLENSSREDKHECPFGRSAIELTKMLCEILQVGELPNEGRNDYHPMF FTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQITRALPSK PNSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEIL ELIKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNP QGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSIL YDPDETLNFIAPNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMK LRLLDLENIQIPEAPPPIPKEPSSYDFVYHYG
    • Molecular weight

      95 kDa including tags
    • Amino acids

      1 to 632

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names

    • CED 12
    • Ced 12 homolog 2
    • CED 12 homolog A
    • CED 12A
    • CED-12
    • ced-12 homolog 2
    • CED12
    • CED12 homolog A
    • CED12, C. elegans, homolog of, 2
    • CED12A
    • ELMO 2
    • ELMO-2
    • ELMO2
    • ELMO2_HUMAN
    • Engulfment and cell motility 2
    • Engulfment and cell motility 2 (ced 12 homolog, C. elegans)
    • Engulfment and cell motility gene 2
    • Engulfment and cell motility protein 2
    • FLJ11656
    • hCED 12A
    • hCED-12A
    • hCED12A
    • KIAA1834
    • OTTHUMP00000031762
    • PH domain protein CED12A
    • Protein ced 12 homolog A
    • Protein ced-12 homolog A
    see all
  • Function

    Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.
  • Tissue specificity

    Widely expressed, with a higher expression in skeletal muscle, kidney and placenta.
  • Sequence similarities

    Contains 1 ELMO domain.
    Contains 1 PH domain.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytosol. Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131840 at approximately 95.26 kDa.

References

ab131840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up