For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-emap-iiaimp1-protein-his-tag-ab219664.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Intracellular Kinases
Share by email

Recombinant Human EMAP II/AIMP1 protein (His tag) (ab219664)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human EMAP II/AIMP1 protein (His tag) (ab219664)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE

    Description

    • Product name

      Recombinant Human EMAP II/AIMP1 protein (His tag)
      See all EMAP II/AIMP1 proteins and peptides
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      Escherichia coli
    • Accession

      Q12904
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        ANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVE NAKLKKEIEELKQELIQAEIQNGVKQIPFPSGTPLHANSMVSENVIQSTA VTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPID VSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQ MQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRI TFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVC RAQTMSNSGIK
      • Predicted molecular weight

        35 kDa including tags
      • Amino acids

        2 to 312
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-EMAP II/AIMP1 antibody [546-2] (ab15693)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-EMAP II/AIMP1 antibody [EPR14168(B)] (ab188320)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)
      • Anti-EMAP II/AIMP1 antibody (ab96506)

    Specifications

    Our Abpromise guarantee covers the use of ab219664 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Additional notes

       This product was previously labelled as EMAP II

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.40
      Constituents: 5% Trehalose, PBS

      Lyophilized from 0.22 µm filtered solution.
      5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    • Reconstitution
      Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

    General Info

    • Alternative names

      • AIMP 1
      • Aimp1
      • AIMP1/p43
      • AIMP1_HUMAN
      • Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
      • ARS interacting multifunctional protein 1
      • EMAP 2
      • EMAP-2
      • EMAP-II
      • EMAP2
      • EMAPII
      • Endothelial monocyte activating polypeptide
      • Endothelial monocyte activating polypeptide 2
      • Endothelial monocyte-activating polypeptide 2
      • Endothelial monocyte-activating polypeptide II
      • HLD3
      • Multisynthase complex auxiliary component p43
      • Multisynthetase complex auxiliary component p43
      • OTTHUMP00000219673
      • p43
      • Scye 1
      • Scye1
      • Scye1, formerly
      • Small inducible cytokine subfamily E member 1
      • Small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating)
      • Small inducible cytokine subfamily E, member 1, formerly
      see all
    • Function

      Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7.
    • Involvement in disease

      Defects in AIMP1 are the cause of leukodystrophy hypomyelinating type 3 (HLD3) [MIM:260600]. A severe autosomal recessive hypomyelinating leukodystrophy characterized by early infantile onset of global developmental delay, lack of development, lack of speech acquisition, and peripheral spasticity associated with decreased myelination in the central nervous system.
    • Sequence similarities

      Contains 1 tRNA-binding domain.
    • Post-translational
      modifications

      Cleaved by caspase-7 in response to apoptosis to produce EMAP-II.
    • Cellular localization

      Nucleus. Cytoplasm > cytosol. Cytoplasmic vesicle > secretory vesicle. Secreted. Endoplasmic reticulum. Golgi apparatus. Enriched in secretory vesicles of pancreatic alpha cells and secreted from the pancreas in response to low glucose levels (By similarity). Also secreted in response to hypoxia and both apoptotic and necrotic cell death.
    • Target information above from: UniProt accession Q12904 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human EMAP II/AIMP1 protein (His tag) (ab219664)
      SDS-PAGE - Recombinant Human EMAP II/AIMP1 protein (His tag) (ab219664)

      ab219664 under reducing (R) conditions.

      The gel was stained overnight with Coomassie Blue.

      The purity of the protein is greater than 95%.

      The protein migrates as 36 kDa under reducing (R) conditions.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab219664? Please let us know so that we can cite the reference in this datasheet.

    ab219664 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab219664.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.