Overview

  • Product name

    Recombinant Human Embigin homolog protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEI MANNFSLESHNISLTEHSSMPVEKNITLERPSNVNLTCQFTTSGDLNAVN VTWKKDGEQLENNYLVSATGSTLYTQYRFTIINSKQMGSYSCFFREEKEQ RGTFNFKVPELHGKNKPLISYVGDSTVLTCKCQNCFPLNWTWYSSNGSVK VPVGVQMNKYVINGTYANETKLKITQLLEEDGESYWCRALFQLGESEEHI ELVVLSYLVPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDEGKEFEQ IEQLKSDDSNGIENNVPRHRKNESLGQ
    • Amino acids

      1 to 327
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Emb
    • EMB_HUMAN
    • Embigin
    • embigin homolog
    • Embigin homolog (mouse)
    • MGC71745
    • OTTHUMP00000161812
    • OTTHUMP00000221477
    • OTTHUMP00000221478
    • OTTHUMP00000221479
    see all
  • Function

    May function as a regulator of cell/ECM interactions during development and in the homeostasis of normal adult tissues.
  • Sequence similarities

    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab153598 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up