Overview

  • Product name
    Recombinant Human EMILIN2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GPKDPVKTLRPTPARPRNSLKKATDNEPSQFSEPRKTLSPTGTAQPSWGV DPKEGPQELQEKKIQVLEEKVLRLTRTVLDLQSSLAGVSENLKHATQDDA SRTRAPGLSS
    • Amino acids
      121 to 230
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Elastin microfibril interface-located protein 2
    • Elastin microfibril interfacer 2
    • EMIL2_HUMAN
    • EMILIN-2
    • EMILIN2
    • extracellular glycoprotein EMILIN-2
    • FOAP-10
    • Protein FOAP-10
    see all
  • Function
    May be responsible for anchoring smooth muscle cells to elastic fibers, and may be involved not only in the formation of the elastic fiber, but also in the processes that regulate vessel assembly. Has cell adhesive capacity.
  • Tissue specificity
    Highest levels are present in fetal heart and adult lung. Intermediate levels in peripheral leukocytes, placenta, and spinal cord and low expression in fetal brain, spleen, thymus, and lung and in adult heart, aorta, testis, bone marrow, small intestine, thymus, lymph node, and appendix.
  • Sequence similarities
    Contains 1 C1q domain.
    Contains 1 collagen-like domain.
    Contains 1 EMI domain.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix. Found mainly at the interface between amorphous elastin and microfibrils.
  • Information by UniProt

Images

  • ab164482 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up