Overview

  • Product name
    Recombinant Human EML4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAM YNEIYNHDTLRW
    • Amino acids
      1 to 62
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EML4
    • C2orf2
    • Echinoderm microtubule associated protein like 4
    • Echinoderm microtubule-associated protein-like 4
    • ELP 120
    • ELP120
    • EMAL4_HUMAN
    • EMAP 4
    • EMAP-4
    • EMAP4
    • EML 4
    • eml4
    • Restrictedly overexpressed proliferation associated protein
    • Restrictedly overexpressed proliferation-associated protein
    • Ropp 120
    • ROPP120
    see all
  • Function
    May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.
  • Sequence similarities
    Belongs to the WD repeat EMAP family.
    Contains 9 WD repeats.
  • Developmental stage
    Strongly overexpressed during mitosis.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab162158 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up