Overview

  • Product name

    Recombinant Human EMP2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTV INDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSI IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF ACTFISGMMYLILRKRK
    • Molecular weight

      46 kDa including tags
    • Amino acids

      1 to 167

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EMP 2
    • EMP-2
    • EMP2
    • EMP2_HUMAN
    • Epithelial membrane protein 2
    • Protein XMP
    see all
  • Sequence similarities

    Belongs to the PMP-22/EMP/MP20 family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152364 stained with Coomassie Blue.

References

ab152364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

The laboratory has not tested the activity of this protein yet, so we are not sure if it’s active.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up