Overview

  • Product name

    Recombinant Human ENC1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL HAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLEL LLDYAYSSRVIINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCL GMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSE ELETEDERLVYESAINWISYDLKKRYCYLPELLQTVRLALLPAIYLMENV AMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGS ENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAAT GCLPASPSVSLKQVEHYDPTINKWTMVAPLREGVSNAAVVSAKLKLFAFG GTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGD TEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS
    • Molecular weight

      93 kDa including tags
    • Amino acids

      1 to 589

Specifications

Our Abpromise guarantee covers the use of ab132598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCL 28
    • CCL28
    • Ectoderm neural cortex protein 1
    • Ectoderm-neural cortex protein 1
    • Ectodermal neural cortex (with BTB like domain)
    • ENC 1
    • ENC-1
    • ENC1
    • ENC1_HUMAN
    • FLJ39259
    • Kelch like 35
    • Kelch like 37
    • Kelch-like protein 37
    • KLHL 35
    • KLHL35
    • KLHL37
    • NRPB
    • Nuclear matrix protein NRP/B
    • Nuclear restricted protein BTB domain like (brain)
    • OTTHUMP00000128235
    • OTTHUMP00000222054
    • p53 induced gene 10 protein
    • p53-induced gene 10 protein
    • PIG 10
    • PIG10
    • TP53I10
    • Tumor protein p53 inducible protein 10
    see all
  • Function

    Actin-binding protein involved in the regulation of neuronal process formation and in differentiation of neural crest cells. May be down-regulated in neuroblastoma tumors. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity

    Detected in fetal brain tissue, moderate expression in fetal heart, lung and kidney. Highly expressed in adult brain, particularly high in the hippocampus and amygdala, and spinal chord. Detectable in adult pancreas.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Developmental stage

    Dramatically up-regulated upon neuronal differentiation.
  • Post-translational
    modifications

    Ubiquitinated and probably targeted for proteasome-independent degradation.
  • Cellular localization

    Nucleus matrix. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132598 stained with Coomassie Blue.

References

ab132598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up