Overview

  • Product name

    Recombinant Human Endo G protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ELPPVPGGPRGPGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQL RPERLRGDGDRRECDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHR WSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGP LFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVM PNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
    • Molecular weight

      53 kDa including tags
    • Amino acids

      50 to 297

Specifications

Our Abpromise guarantee covers the use of ab131799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EndoG
    • Endonuclease G
    • Endonuclease G mitochondrial
    • EndonucleaseG
    • FLJ27463
    • Mitochondrial endonuclease G
    • NUCG_HUMAN
    see all
  • Relevance

    Endo G is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein cleaves DNA at GC tracts. It is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
  • Cellular localization

    Cytoplasmic, Mitochondrial and Nuclear

Images

  • 12.5% SDS-PAGE analysis of ab131799 stained with Coomassie Blue.

References

ab131799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up