Overview

  • Product name

    Recombinant Human ENDOGL1/ENGL protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEG ARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
    • Amino acids

      269 to 368
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ENDOGL1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Endo G like 1
    • Endo G-like 1
    • Endo/exonuclease (5'-3'), endonuclease G like
    • ENDOGL 1
    • ENDOGL1
    • ENDOGL2
    • Endonuclease G like 1
    • Endonuclease G like 2
    • Endonuclease G-like 1
    • ENGL
    • ENGL a
    • ENGL B
    • ENGLA
    • ENGLB
    • Exog
    • EXOG_HUMAN
    • MGC125944
    • MGC125945
    • mitochondrial
    • Nuclease EXOG
    • Nuclease EXOG mitochondrial
    see all
  • Function

    Endo/exonuclease with nicking activity towards supercoiled DNA, a preference for single stranded DNA and 5'-3' exonuclease activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the DNA/RNA non-specific endonuclease family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab160724 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up