Description

  • Product name

    Recombinant Human Endothelin A Receptor/ET-A protein
    See all Endothelin A Receptor/ET-A proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVT THQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNAT LLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDH NDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL VTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEF YQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLM DYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPM NGTSIQWKNHDQNNHNTDRSSHKDSMN
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 427

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ednra
    • EDNRA_HUMAN
    • Endothelin 1 receptor precursor
    • Endothelin 1 specific receptor
    • Endothelin A receptor
    • Endothelin ET A receptor
    • Endothelin receptor ET1 specific type
    • Endothelin receptor subtype A
    • Endothelin receptor type A
    • Endothelin-1 receptor
    • ET A
    • ET-A
    • ETA
    • ETA R
    • ETA-R
    • ETAR
    • ETRA
    • G protein coupled receptor
    • hET AR
    • hET-AR
    • MFDA
    see all
  • Function

    Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
  • Tissue specificity

    Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152357 stained with Coomassie Blue.

References

ab152357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up