Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADISFLACVM ECEGKLPSLKIWETCKELLQLSRPELPQDGTSTLRENSKPEESHLLAKRY GGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSL ANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLE DEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESY SKEVPEMEKRYGGFMRF
    • Amino acids

      1 to 267
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ENK
    • Enkephalin
    • Enkephalin A
    • Met-enkephalin-Arg-Phe
    • OGF
    • Opioid growth factor
    • PENK
    • PENK_HUMAN
    • Preproenkephalin
    • Proenkephalin
    • Proenkephalin A
    see all
  • Function

    Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum.
  • Sequence similarities

    Belongs to the opioid neuropeptide precursor family.
  • Post-translational
    modifications

    The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab159087 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up