Description

  • Product name

    Recombinant Human ENL protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEK VVFWLHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCF TYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGADT VSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKE HRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAA FKEPKMALKETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQ KKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPREA KKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQG PLRSMVEDLQSEESDEDDSSSGEEAAGKTNPGRDSRLSFSDSESDNSADS SLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGTYDKAYTDELV ELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKL QSCLEAVAT
    • Amino acids

      1 to 559
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ENL
    • ENL_HUMAN
    • LTG19
    • MLLT1
    • Myeloid/lymphoid or mixed lineage leukemia trithorax (Drosophila)
    • Protein ENL
    • YEATS domain containing protein 1
    • YEATS domain-containing protein 1
    • YEATS1
    see all
  • Function

    Capable of activating transcription from synthetic reporter genes in both lymphoid and myeloid cells.
  • Involvement in disease

    Note=A chromosomal aberration involving MLLT1 is associated with acute leukemias. Translocation t(11;19)(q23;p13.3) with MLL/HRX. The result is a rogue activator protein.
  • Sequence similarities

    Contains 1 YEATS domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab158901 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up